PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g043617m
Common NameCISIN_1g043617mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family Dof
Protein Properties Length: 292aa    MW: 32584.2 Da    PI: 5.5752
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g043617mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof117.74.6e-371570661
             zf-Dof  6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                        +cprC s+ntkfCyynnysl+qPryfCk+CrryWtkGG+lrnvPvGgg+rkn++ 
  orange1.1g043617m 15 PNCPRCGSSNTKFCYYNNYSLTQPRYFCKGCRRYWTKGGSLRNVPVGGGCRKNRRG 70
                       58***************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-27769IPR003851Zinc finger, Dof-type
PfamPF027012.2E-311569IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.6771569IPR003851Zinc finger, Dof-type
PROSITE patternPS0136101753IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MERVWNHKPN VEISPNCPRC GSSNTKFCYY NNYSLTQPRY FCKGCRRYWT KGGSLRNVPV  60
GGGCRKNRRG KSVRLSTDGV SSKALSYMGE INKVNGFLES TSTSSLMQQQ DGSHIDIALV  120
FANFLNQPPE EKPAGSFELP EFPDIDPSME FNSCMVSTNL ESRVQLPEEN VNNGLVRSLS  180
FSDLSSAETQ THFRDNDQSY YSMFDSVQKH GHHVQDGIQS NQVLPPLPSE EILWLNSQMM  240
MNQSLQAAAA AATHEPMLGP ADDHQAQDPN NLLFGNWSPF DFSSDDTFSK T*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00405DAPTransfer from AT3G52440Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006481859.20.0PREDICTED: dof zinc finger protein DOF3.5
TrEMBLA0A067FTB90.0A0A067FTB9_CITSI; Uncharacterized protein
STRINGPOPTR_0006s21700.14e-83(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM91412238
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52440.16e-45Dof family protein